HORDB

General Information

ID: hor004764
Uniprot ID: Q8LLV8
Protein name: Peptide POLARIS
Gene name: PLS
Organism: Arabidopsis thaliana (Mouse-ear cress)
Family: POLARIS peptide family
Source: Plant
Expression: Repressed by ethylene (ACC) and cytokinin, but induced by auxin (1-NAA and 2,4-D). |First observed in embryos from the heart stage and throughout embryo development, restricted to the basal part, constituting the developing radicle. During the curled coty
Disease: NA
Comments: NA
Taxonomy: Arabidopsis (genus), Camelineae (tribe), Brassicaceae (family), Brassicales (order), malvids, rosids, Pentapetalae, Gunneridae, eudicotyledons, Mesangiospermae, Magnoliopsida (class), Spermatophyta, Euphyllophyta, Tracheophyta, Embryophyta, Streptophytina (subphylum), Streptophyta (phylum), Viridiplantae (kingdom), Eukaryota (superkingdom), cellular organisms
GO MF: GO:0003674 molecular_function
GO BP: GO:0009733 response to auxin; GO:0009734 auxin-activated signaling pathway; GO:0009735 response to cytokinin; GO:0009736 cytokinin-activated signaling pathway; GO:0009873 ethylene-activated signaling pathway; GO:0009926 auxin polar transport; GO:0009955 adaxial/abaxial pattern specification; GO:0010051 xylem and phloem pattern formation; GO:0010105 negative regulation of ethylene-activated signaling pathway; GO:0048364 root development; GO:0070507 regulation of microtubule cytoskeleton organization; GO:0071365 cellular response to auxin stimulus; GO:0071368 cellular response to cytokinin stimulus; GO:0071369 cellular response to ethylene stimulus
GO CC: NA

Sequence Information

Sequence: MKPRLCFNFRRRSISPCYISISYLLVAKLFKLFKIH
Length: 36
Propeptide: MKPRLCFNFRRRSISPCYISISYLLVAKLFKLFKIH
Signal peptide: NA
Modification: NA
Glycosylation: NA
Mutagenesis: NA

Activity

Function: Required for correct root growth and vascular development, probably by modulating both cell division rate in meristems and cell elongation in roots. Negative regulator of the ethylene signaling pathway that modulates microtubule cytoskeleton dynamics and auxin transport and homeostasis, and possibly cytokinin signaling, thus influencing root growth and lateral root development.
Mechanism: NA
Cross BBB: NA
Target: NA
Target Unid: NA
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure

Disulfide bond: NA
Structure ID: AF-Q8LLV8-F1(AlphaFold_DB_ID)

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

AF-Q8LLV8-F1.pdb

hor004764_AF2.pdb

hor004764_ESM.pdb

Physical Information

Mass:	501488	Formula:	C207H331N55O44S3
Absent amino acids:	DEGQTW	Common amino acids:	L
pI:	11.24	Basic residues:	9
Polar residues:	9	Hydrophobic residues:	15
Hydrophobicity:	32.78	Boman Index:	-4010
Half-Life:	30 hour	Half-Life Yeast:	>20 hour
Half-Life E.Coli:	>10 hour	Aliphatic Index	108.33
Instability Index:	4350	Extinction Coefficient cystines:	3105
Absorbance 280nm:	88.71

Literature

PubMed ID: 12172017
Title: The POLARIS gene of Arabidopsis encodes a predicted peptide required for correct root growth and leaf vascular patterning.
PubMed ID: 9368412
Title: Promoter trap markers differentiate structural and positional components of polar development in Arabidopsis.
PubMed ID: 10645417
Title: Dissecting embryonic and seedling morphogenesis in Arabidopsis by promoter trap insertional mutagenesis
PubMed ID: 17138700
Title: The POLARIS peptide of Arabidopsis regulates auxin transport and root growth via effects on ethylene signaling.