General Information

  • ID:  hor004764
  • Uniprot ID:  Q8LLV8
  • Protein name:  Peptide POLARIS
  • Gene name:  PLS
  • Organism:  Arabidopsis thaliana (Mouse-ear cress)
  • Family:  POLARIS peptide family
  • Source:  Plant
  • Expression:  Repressed by ethylene (ACC) and cytokinin, but induced by auxin (1-NAA and 2,4-D). |First observed in embryos from the heart stage and throughout embryo development, restricted to the basal part, constituting the developing radicle. During the curled coty
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Arabidopsis (genus), Camelineae (tribe), Brassicaceae (family), Brassicales (order), malvids, rosids, Pentapetalae, Gunneridae, eudicotyledons, Mesangiospermae, Magnoliopsida (class), Spermatophyta, Euphyllophyta, Tracheophyta, Embryophyta, Streptophytina (subphylum), Streptophyta (phylum), Viridiplantae (kingdom), Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0003674 molecular_function
  • GO BP:  GO:0009733 response to auxin; GO:0009734 auxin-activated signaling pathway; GO:0009735 response to cytokinin; GO:0009736 cytokinin-activated signaling pathway; GO:0009873 ethylene-activated signaling pathway; GO:0009926 auxin polar transport; GO:0009955 adaxial/abaxial pattern specification; GO:0010051 xylem and phloem pattern formation; GO:0010105 negative regulation of ethylene-activated signaling pathway; GO:0048364 root development; GO:0070507 regulation of microtubule cytoskeleton organization; GO:0071365 cellular response to auxin stimulus; GO:0071368 cellular response to cytokinin stimulus; GO:0071369 cellular response to ethylene stimulus
  • GO CC:  NA

Sequence Information

  • Sequence:  MKPRLCFNFRRRSISPCYISISYLLVAKLFKLFKIH
  • Length:  36(1-36)
  • Propeptide:  MKPRLCFNFRRRSISPCYISISYLLVAKLFKLFKIH
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Required for correct root growth and vascular development, probably by modulating both cell division rate in meristems and cell elongation in roots. Negative regulator of the ethylene signaling pathway that modulates microtubule cytoskeleton dynamics and
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q8LLV8-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    AF-Q8LLV8-F1.pdbhor004764_AF2.pdbhor004764_ESM.pdb

Physical Information

Mass: 501488 Formula: C207H331N55O44S3
Absent amino acids: DEGQTW Common amino acids: L
pI: 11.24 Basic residues: 9
Polar residues: 9 Hydrophobic residues: 15
Hydrophobicity: 32.78 Boman Index: -4010
Half-Life / Aliphatic Index: 30 hour Aliphatic Index: 108.33
Instability Index: 4350 Extinction Coefficient cystines: 3105
Absorbance 280nm: 88.71

Literature

  • PubMed ID:  12172017
  • Title:  The POLARIS gene of Arabidopsis encodes a predicted peptide required for correct root growth and leaf vascular patterning.
  • PubMed ID:  9368412
  • Title:   Promoter trap markers differentiate structural and positional components of polar development in Arabidopsis.
  • PubMed ID:  10645417
  • Title:  Dissecting embryoni
  • PubMed ID:  17138700
  • Title: